| Id: | acc3009 |
| Group: | 1sens_supp |
| Protein: | H2AX |
| Gene Symbol: | H2ax |
| Protein Id: | P27661 |
| Protein Name: | H2AX_MOUSE |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cancer |
| Disease: | Ovarian Cancer |
| Disease Subtype: | Ovarian Carcinoma |
| Disease Cellline: | IGROV-1 |
| Disease Info: | |
| Drug: | ST1926 |
| Drug Info: | ST1926 is a drug that may have potential therapeutic effects in relevant medical fields. |
| Effect: | promote |
| Effect Info: | "ST1926 can induce the DNA damage response in ovarian cancer cells, which in turn activates a series of protein kinases related to the DNA damage response, such as ATM, Chk1, and Chk2, and the phosphorylation levels of these proteins increase. In addition, ST1926 can also induce the phosphorylation and acetylation of p53. These modifications enhance the function of p53, thereby promoting apoptosis. The increase in these PTMs has a positive impact on the efficacy of ST1926, enabling ST1926 to more effectively induce apoptosis in ovarian cancer cells." |
| Note: | histone |
| Score: | 4.0 |
| Pubmed(PMID): | 19676051 |
| Sentence Index: | 19676051_4_supp |
| Sentence: | "Indeed, in this study performed in ovarian carcinoma cells, we show that exposure to ST1926 resulted in an increase of early markers of DNA damage, including ATM and H2AX phosphorylation. The sensitization to ST1926-induced apoptosis was associated with an enhanced DNA damage response, because a prolonged expression of DNA damage markers (e.g., H2AX, p53 and RPA-2 phosphorylation) and a marked activation of DNA damage checkpoint kinases (in particular, phosphorylation of Chk1) were observed indicating an accumulation of DNA damage by the ST1926/HDAC inhibitor combination." |
Sequence & Structure:
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPKAPAVGKKASQASQEY
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
