| Id: | acc3031 |
| Group: | 2sens |
| Protein: | RhoA |
| Gene Symbol: | RHOA |
| Protein Id: | P61586 |
| Protein Name: | RHOA_HUMAN |
| PTM: | geranylgeranylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cancer |
| Disease: | Colorectal Cancer |
| Disease Subtype: | |
| Disease Cellline: | COLO 320DM |
| Disease Info: | |
| Drug: | GGTI-298 |
| Drug Info: | "GGTI - 298 is a drug, which may be used in relevant medical research and treatment." |
| Effect: | modulate |
| Effect Info: | "GGTI-298 inhibits the geranylgeranylation of RhoA, prevents its membrane localization, and reduces cancer cell invasion." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 14598891 |
| Sentence Index: | 14598891_7-8 |
| Sentence: | "FTI-277 and GGTI-298 decreased the growth potential of COLO 320DM cells, but the inhibitory effect of GGTI-298 was rather selective toward invasion in association with changes in cell morphology and RhoA localization. These results suggest that geranylgeranylation of RhoA by geranylgeranyltransferase type I is critical for cancer cell invasion, and inhibition of geranylgeranyltransferase type I activity should offer a novel approach to the treatment of invasion and metastasis of cancer cells resistant to farnesyltransferase inhibitors." |
Sequence & Structure:
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
