PMADS

Id:	acc3117
Group:	2sens
Protein:	histone H3
Gene Symbol:	H3C1
Protein Id:	P68431
Protein Name:	H31_HUMAN
PTM:	phosphorylation
Site:	Ser10
Site Sequence:	MARTKQTARKSTGGKAPRKQL
Disease Category:	Cancer
Disease:	Breast Cancer
Disease Subtype:
Disease Cellline:	MCF-7
Disease Info:
Drug:	cisplatin
Drug Info:	Cisplatin is a widely used chemotherapy drug that is effective in treating various types of cancers.
Effect:	modulate
Effect Info:	Loss of histone H4 lysine 20 trimethylation and increased histone H3 serine 10 phosphorylation in drug-resistant cells.
Note:	histone
Score:	3.0
Pubmed(PMID):	17363502
Sentence Index:	17363502_3-4
Sentence:	"In the present study, we examined the alterations in epigenetic mechanisms in the drug-resistant MCF-7 human breast cancer cells induced by doxorubicin (DOX) and cisplatin (cisDDP), two chemotherapeutic drugs with different modes of action. Despite this difference, both of the drug-resistant cell lines displayed similar pronounced changes in the global epigenetic landscape showing loss of global DNA methylation, loss of histone H4 lysine 20 trimethylation, increased phosporylation of histone H3 serine 10, and diminished expression of Suv4-20h2 histone methyltransferase compared with parental MCF-7 cells."

Sequence & Structure:

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

Residue	Position	State	Disease	Class	PMID
S	10	D	Breast cancer	Phosphorylation	21146603
S	10	U	Breast adenocarcinoma	Phosphorylation	16461563

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links:

CTD
DMRdb