Id: | acc3128 |
Group: | 2sens |
Protein: | IPP5 |
Gene Symbol: | PPP1R1C |
Protein Id: | Q8WVI7 |
Protein Name: | PPR1C_HUMAN |
PTM: | phosphorylation |
Site: | Thr40 |
Site Sequence: | RRPTPASLVILNEHNPPEIDD |
Disease Category: | Cancer |
Disease: | Colorectal Cancer |
Disease Subtype: | Colorectal Adenocarcinoma |
Disease Cellline: | SW620 |
Disease Info: | |
Drug: | IPP5 OE |
Drug Info: | IPP5 OE is a drug that may play a certain role in relevant medical or biological research. |
Effect: | modulate |
Effect Info: | "IPP5 is a novel protein phosphatase 1 (PP1) inhibitor that can promote the G1/S phase transition of SW480 colon cancer cells, and its activity depends on the phosphorylation of the Thr - 40 site." |
Note: | Non-conventional drugs |
Score: | 3.0 |
Pubmed(PMID): | 18310074 |
Sentence Index: | 18310074_4-5 |
Sentence: | "Furthermore, the mutation of Thr-40 within the inhibitory subunit of IPP5 into Ala eliminates the phosphorylation of IPP5 by protein kinase A and its inhibitor activity to PP1, whereas the mutation of Thr-40 within a truncated form of IPP5 into Asp can serve as a dominant active form of IPP5 in inhibiting PP1 activity. In IPP5-negative SW480 and IPP5-highly positive SW620 human colon cancer cells, we find that overexpression of IPP5 promotes the growth and accelerates the G(1)-S transition of SW480 cells in a Thr-40-dependent manner, which could be reversed by downregulation of the PP1 expression." |
Sequence & Structure:
MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
No data.
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.