Id: acc3128
Group: 2sens
Protein: IPP5
Gene Symbol: PPP1R1C
Protein Id: Q8WVI7
Protein Name: PPR1C_HUMAN
PTM: phosphorylation
Site: Thr40
Site Sequence: RRPTPASLVILNEHNPPEIDD
Disease Category: Cancer
Disease: Colorectal Cancer
Disease Subtype: Colorectal Adenocarcinoma
Disease Cellline: SW620
Disease Info:
Drug: IPP5 OE
Drug Info: IPP5 OE is a drug that may play a certain role in relevant medical or biological research.
Effect: modulate
Effect Info: "IPP5 is a novel protein phosphatase 1 (PP1) inhibitor that can promote the G1/S phase transition of SW480 colon cancer cells, and its activity depends on the phosphorylation of the Thr - 40 site."
Note: Non-conventional drugs
Score: 3.0
Pubmed(PMID): 18310074
Sentence Index:
Sentence:

Sequence & Structure:

MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: