Id: | acc3140 |
Group: | 2sens |
Protein: | GSK3beta |
Gene Symbol: | Gsk3b |
Protein Id: | Q9WV60 |
Protein Name: | GSK3B_MOUSE |
PTM: | phosphorylation |
Site: | Ser9 |
Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
Disease Category: | Nervous system diseases |
Disease: | Alzheimer's Disease |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | A-582941 |
Drug Info: | A-582941 is a drug with its own distinct pharmacological properties and potential applications in the medical field. |
Effect: | modulate |
Effect Info: | "A-582941 can significantly inhibit the phosphorylation level of tau. It is speculated that it inhibits the excessive phosphorylation of tau by enhancing the phosphorylation of GSK3β at the Ser9 site, indicating that nAChR agonists are promising for the treatment of tauopathies such as AD." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 19230830 |
Sentence Index: | 19230830_3-4 |
Sentence: | "In this study, we investigated whether alpha7 nAChR agonism leads to increased phosphorylation of the inhibitory regulating amino acid residue Ser-9 on GSK3beta, a major kinase responsible for tau hyperphosphorylation in AD neuropathology. Immunohistochemical analysis revealed that the selective alpha7 agonist A-582941 increased S(9)-GSK3beta phosphorylation in mouse cingulate cortex and hippocampus that was not observed in alpha7 nAChR knock-out mice." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.