Id: | acc3149 |
Group: | 2sens |
Protein: | Cdc25C |
Gene Symbol: | CDC25C |
Protein Id: | P30307 |
Protein Name: | MPIP3_HUMAN |
PTM: | phosphorylation |
Site: | Ser198 |
Site Sequence: | EISDELMEFSLKDQEAKVSRS |
Disease Category: | Cancer |
Disease: | Hepatocellular Carcinoma |
Disease Subtype: | |
Disease Cellline: | Hep3B |
Disease Info: | |
Drug: | HKH40A |
Drug Info: | "HKH40A is a drug with potential medical applications, although specific details about it are not provided." |
Effect: | modulate |
Effect Info: | "Inhibiting the activity of Cdc25C through Chk1/2 - mediated inhibitory phosphorylation leads to the phosphorylation of downstream Cdk1 and cell cycle G2/M arrest, thereby inducing cell apoptosis." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 19530246 |
Sentence Index: | 19530246_3-4 |
Sentence: | "We found that HKH40A activated ataxia telangiectasia mutated (ATM) kinase, which then triggered activation of the Chk1/2 signaling pathway, evidenced by Chk1/2 mediated inhibitory phosphorylation of Cdc25C protein phosphatase. This resulted in Cdk1 tyrosine phosphorylation at Tyr-15, leading to cell cycle block at G2/M phase." |
Sequence & Structure:
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
CDC25C-Ser168 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | 0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
CDC25C-Ser216 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.236 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.481 | ||||
HNSC | 0.035 | ||||
LUAD | -0.999 | ||||
LUSC | -1.233 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.48 |
CDC25C-Ser263 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
CDC25C-Thr48 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.88 | ||||
COAD | |||||
HGSC | 1.793 | ||||
ccRCC | |||||
GBM | 0.534 | ||||
HNSC | -0.09 | ||||
LUAD | -0.562 | ||||
LUSC | -1.134 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.339 |
CDC25C-Tyr165 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | -0.707 |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | 0.707 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | P | Leukemia | Phosphorylation | 11202906 |
S | 216 | U | Colorectal carcinoma | Phosphorylation | 35999268 |
S | 216 | U | High-grade serous ovarian carcinoma | Phosphorylation | 35017636 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.