Id: | acc3157 |
Group: | 2sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63086 |
Protein Name: | MK01_RAT |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HTGFLTEYVATRWYRAPEIML |
Disease Category: | Urinary and reproductive system diseases |
Disease: | Nephritis |
Disease Subtype: | chronic mesangioproliferative glomerulonephritis |
Disease Cellline: | |
Disease Info: | |
Drug: | candesartan |
Drug Info: | Candesartan is an angiotensin II receptor blocker (ARB) used to treat high blood pressure and heart failure. It helps relax blood vessels to lower blood pressure. |
Effect: | modulate |
Effect Info: | ANG II receptor blockers can improve chronic mesangioproliferative glomerulonephritis (GN) by reducing p-ERK5. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 19846573 |
Sentence Index: | 19846573_9-10 |
Sentence: | "Treatment of GN rats with an ANG II type 1 receptor blocker resulted in significant decreases in phospho-ERK5 expression and collagen accumulation accompanied by remarkable histological improvement. Taken together, these results suggest that MC ERK5 phosphorylation by ANG II or H(2)O(2) enhances cell viability and ECM accumulation in an experimental model of chronic GN." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | A | Basophilic leukemia | Phosphorylation | 11971018 |
T | 183 | D | Major depressive disorder | Phosphorylation | 16959794 |
Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
T | 183 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.