| Id: | acc3161 |
| Group: | 2sens |
| Protein: | Smad1 |
| Gene Symbol: | Smad1 |
| Protein Id: | P70340 |
| Protein Name: | SMAD1_MOUSE |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Immune system diseases |
| Disease: | Fibrodysplasia Ossificans Progressiva |
| Disease Subtype: | |
| Disease Cellline: | C2C12 |
| Disease Info: | |
| Drug: | mutant ALK2-R206H receptor |
| Drug Info: | "The <|Drug|> is a mutant ALK2 - R206H receptor, which is likely a specific mutated form of the ALK2 receptor with the R206H mutation. " |
| Effect: | modulate |
| Effect Info: | The mutated ALK2-R206H receptor increases the phosphorylation of the downstream Smad1 effector protein. |
| Note: | Non-conventional drugs |
| Score: | 3.0 |
| Pubmed(PMID): | 19929436 |
| Sentence Index: | 19929436_3-4 |
| Sentence: | "Expression of the mutant ALK2-R206H receptor (FOP-ALK2) results in increased phosphorylation of the downstream Smad1 effector proteins and elevated basal BMP-dependent transcriptional reporter activity, indicating that FOP-ALK2 is constitutively active. FOP-ALK2-induced transcriptional activity could be blocked by overexpressing either of the inhibitory Smads, Smad6 or -7, or by treatment with the pharmacological BMP type I receptor inhibitor dorsomorphin." |
Sequence & Structure:
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMAQDGSQPMDTNMMAPPLPAEISRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
