| Id: | acc3162 |
| Group: | 2sens |
| Protein: | GSK3beta |
| Gene Symbol: | Gsk3b |
| Protein Id: | P18266 |
| Protein Name: | GSK3B_RAT |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Infarction |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | ischemic post-conditioning |
| Drug Info: | "Ischemic post - conditioning is a technique rather than a drug. It refers to a series of brief, intermittent episodes of ischemia and reperfusion applied at the onset of reperfusion after a prolonged ischemic event, which can reduce the extent of ischemia - reperfusion injury. " |
| Effect: | modulate |
| Effect Info: | Ischemic post - conditioning reduces the myocardial infarct size by activating the PI3K/Akt signaling pathway and increasing the phosphorylation level of GSK - 3β. |
| Note: | Non-conventional drugs |
| Score: | 3.0 |
| Pubmed(PMID): | 20054613 |
| Sentence Index: | 20054613_11-12 |
| Sentence: | "Western blot analysis revealed that post-conditioning increased the phosphorylationation of GSK-3beta by 2.3 times (P < 0.01), and this increase could be blocked by wortmannin, a PI3-kinase inhibitor. Although rapamycin blocked the infarct size reduction, phosphorylationation of p70S6K was not increased in post-conditioned hearts." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
