| Id: | acc3163 |
| Group: | 2sens |
| Protein: | GSK3alpha |
| Gene Symbol: | Gsk3a |
| Protein Id: | Q2NL51 |
| Protein Name: | GSK3A_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser21 |
| Site Sequence: | GGSGRARTSSFAEPGGGGGGG |
| Disease Category: | Genetic diseases |
| Disease: | Fragile X Syndrome |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Lithium |
| Drug Info: | "Lithium is a drug commonly used in the treatment of bipolar disorder, helping to stabilize mood swings." |
| Effect: | modulate |
| Effect Info: | "Inhibitory phosphorylation of GSK3 is significantly down - regulated in multiple tissues (brain, testis, liver) in the FXS mouse model. Lithium can restore its phosphorylation state, relieve macroorchidism and inhibit the activation response of astrocytes in the brain. " |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 20600866 |
| Sentence Index: | 20600866_3-4 |
| Sentence: | "The inhibitory serine phosphorylation of glycogen synthase kinase-3 (GSK3) is lower in brain regions of Fmr1 knockout mice than wild-type mice and the GSK3 inhibitor lithium rescues several behavioral impairments in Fmr1 knockout mice. Therefore, we examined if the serine phosphorylation of GSK3 in Fmr1 knockout mice also was altered outside the brain and if administration of lithium ameliorated the macroorchidism phenotype." |
Sequence & Structure:
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPSGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATVGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLITPIIYIKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSSKTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRRLGAQLPNDRPLPPLFNFSPGELSIQPSLNAILIPPHLRSPAGPASPLTTSYNPSSQALTEAQTGQDWQPSDATTATLASSS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
