Id: | acc3219 |
Group: | 2sens |
Protein: | GSK3beta |
Gene Symbol: | Gsk3b |
Protein Id: | Q9WV60 |
Protein Name: | GSK3B_MOUSE |
PTM: | phosphorylation |
Site: | Ser9 |
Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Diabetes Mellitus |
Disease Subtype: | testicular oxidative damage |
Disease Cellline: | |
Disease Info: | |
Drug: | TPEN |
Drug Info: | "TPEN is a chelating agent that can bind to metal ions, which is often used in biological and chemical research." |
Effect: | modulate |
Effect Info: | "Zinc deficiency significantly enhanced the decrease in Akt and GSK - 3β phosphorylation (Fig. 1A, B) and the increase in GS phosphorylation caused by diabetes, thus exacerbating the testicular glucose metabolism changes and inflammation induced by diabetes." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 22000581 |
Sentence Index: | 22000581_4-5 |
Sentence: | "After diabetes onset induced by streptozotocin, both diabetic and age-matched control mice were given TPEN intraperitoneally for 4 months. Western blotting assay revealed that Akt-mediated glucose metabolism signaling was down-regulated in the diabetic testis and was further decreased in diabetic mice with Zn deficiency, reflected by reduced phosphorylation of both Akt and GSK-3beta and increased phosphorylation of glycogen synthase along with a disarrangement of fatty acid metabolism (increased expression of PPAR-alpha and decreased adenosine-monophosphate-activated protein kinase phosphorylation)." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.