Id: acc3219
Group: 2sens
Protein: GSK3beta
Gene Symbol: Gsk3b
Protein Id: Q9WV60
Protein Name: GSK3B_MOUSE
PTM: phosphorylation
Site: Ser9
Site Sequence: -MSGRPRTTSFAESCKPVQQP
Disease Category: Endocrine and metabolic diseases
Disease: Diabetes Mellitus
Disease Subtype: testicular oxidative damage
Disease Cellline:
Disease Info:
Drug: TPEN
Drug Info: "TPEN is a chelating agent that can bind to metal ions, which is often used in biological and chemical research."
Effect: modulate
Effect Info: "Zinc deficiency significantly enhanced the decrease in Akt and GSK - 3β phosphorylation (Fig. 1A, B) and the increase in GS phosphorylation caused by diabetes, thus exacerbating the testicular glucose metabolism changes and inflammation induced by diabetes."
Note:
Score: 4.0
Pubmed(PMID): 22000581
Sentence Index:
Sentence:

Sequence & Structure:

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: