Id: | acc3224 |
Group: | 2sens |
Protein: | ERK1 |
Gene Symbol: | MAPK3 |
Protein Id: | A0A1B0GUI7 |
Protein Name: | BRDOS_HUMAN |
PTM: | Phosphorylation |
Site: | Tyr204 |
Site Sequence: | ----------------------------------------------------------------------------------------------------------------------------------- |
Disease Category: | Systemic diseases |
Disease: | Fibrotic Disorder |
Disease Subtype: | |
Disease Cellline: | porcine valvular interstitial cells |
Disease Info: | |
Drug: | Terguride |
Drug Info: | "Terguride is a drug, which may have specific pharmacological effects and is used to treat certain medical conditions." |
Effect: | modulate |
Effect Info: | "Telgulid can inhibit 5-HT-induced human platelet aggregation and 5-HT-induced cell proliferation signaling pathways (ERK1/2 phosphorylation and collagen synthesis) in porcine valve interstitial cells, and has potential therapeutic value in the treatment of fibrotic diseases." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 22049464 |
Sentence Index: | 22049464_11-12 |
Sentence: | "In these cells, the stimulatory effect of 5-HT on [3H]proline incorporation (index of extracellular matrix collagen) was blocked by terguride. Because of the inhibition of both 5-HT(2A) and 5-HT(2B) receptors, platelet aggregation, and cellular proliferation and activity (ERK1/2 phosphorylation and collagen production) terguride may have therapeutic potential in the treatment of fibrotic disorders." |
Sequence & Structure:
MSGRVPLAEKALSEGYARLRYRDTSLLIWQQQQQKLESVPPGTYLSRSRSMWYSQYGNEAILVRDKNKLEVSRDTGQSKFCTIM
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.