Id: acc3224
Group: 2sens
Protein: ERK1
Gene Symbol: MAPK3
Protein Id: A0A1B0GUI7
Protein Name: BRDOS_HUMAN
PTM: Phosphorylation
Site: Tyr204
Site Sequence: -----------------------------------------------------------------------------------------------------------------------------------
Disease Category: Systemic diseases
Disease: Fibrotic Disorder
Disease Subtype:
Disease Cellline: porcine valvular interstitial cells
Disease Info:
Drug: Terguride
Drug Info: "Terguride is a drug, which may have specific pharmacological effects and is used to treat certain medical conditions."
Effect: modulate
Effect Info: "Telgulid can inhibit 5-HT-induced human platelet aggregation and 5-HT-induced cell proliferation signaling pathways (ERK1/2 phosphorylation and collagen synthesis) in porcine valve interstitial cells, and has potential therapeutic value in the treatment of fibrotic diseases."
Note:
Score: 4.0
Pubmed(PMID): 22049464
Sentence Index:
Sentence:

Sequence & Structure:

MSGRVPLAEKALSEGYARLRYRDTSLLIWQQQQQKLESVPPGTYLSRSRSMWYSQYGNEAILVRDKNKLEVSRDTGQSKFCTIM

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: