| Id: | acc3234 |
| Group: | 2sens |
| Protein: | GSK3beta |
| Gene Symbol: | Gsk3b |
| Protein Id: | P18266 |
| Protein Name: | GSK3B_RAT |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Acute Hyperhomocysteinemia |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Homocysteine |
| Drug Info: | Homocysteine is an amino acid that is involved in various biochemical processes in the body. Elevated levels of homocysteine are associated with an increased risk of cardiovascular disease. |
| Effect: | modulate |
| Effect Info: | "Acute hyperhomocysteinemia leads to Tau protein phosphorylation by upregulating Akt phosphorylation and inhibiting GSK - 3β phosphorylation, which is associated with neuroinflammation and brain dysfunction." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 22525229 |
| Sentence Index: | 22525229_9-10 |
| Sentence: | "Furthermore, chronic hyperhomocysteinemia did not alter Akt and GSK-3beta phosphorylation at 1h and 12h after the last administration of this amino acid. Our data showed that Akt, NF-kappaB/p65, GSK-3beta and Tau protein are activated in hippocampus of rats subjected to acute hyperhomocysteinemia, suggesting that these signaling pathways may be, at least in part, important contributors to the neuroinflammation and/or brain dysfunction observed in some hyperhomocystinuric patients." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
