| Id: | acc3267 |
| Group: | 2sens |
| Protein: | p65 |
| Gene Symbol: | Rela |
| Protein Id: | P58546 |
| Protein Name: | MTPN_HUMAN |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Other |
| Disease: | Pancreatitis |
| Disease Subtype: | acute pancreatitis |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Pioglitazone |
| Drug Info: | Pioglitazone is an oral diabetes medicine that helps control blood sugar levels. It belongs to the thiazolidinedione class of drugs. |
| Effect: | modulate |
| Effect Info: | "After pioglitazone pretreatment, the phosphorylation level of NF-κB p65 protein decreased, inhibiting the activation of NF-κB and thus alleviating the inflammatory response in the pancreas." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 24185678 |
| Sentence Index: | 24185678_9-10 |
| Sentence: | "Furthermore, caspase 3 activity was high in SAP but low in MAP, implying that the apoptotic mechanism in pancreatic acinar cells of AP rats was correlated with caspase 3 activity. Phosphorylation of p65 was reduced in SAP or MAP group pretreated with pioglitazone, indicating that pioglitazone reduced the inflammation reaction by inhibiting the activation of the NF-kappaB." |
Sequence & Structure:
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
