| Id: | acc3271 |
| Group: | 2sens |
| Protein: | MGMT |
| Gene Symbol: | MGMT?? |
| Protein Id: | P16455 |
| Protein Name: | MGMT_HUMAN |
| PTM: | ubiquitination |
| Site: | Cys145 |
| Site Sequence: | GNPVPILIPCHRVVCSSGAVG |
| Disease Category: | Cancer |
| Disease: | Glioblastoma |
| Disease Subtype: | |
| Disease Cellline: | T98 |
| Disease Info: | |
| Drug: | disulfiram (DSF) |
| Drug Info: | "Disulfiram (DSF) is a drug used for the treatment of chronic alcoholism, which causes unpleasant effects when alcohol is consumed." |
| Effect: | modulate |
| Effect Info: | "Disulfiram modifies the key site Cys145 of MGMT, induces its ubiquitination and degradation, and inhibits the activity of MGMT, thereby enhancing alkylation damage and improving the sensitivity of brain tumors to DNA alkylating drugs." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 24193513 |
| Sentence Index: | 24193513_2-3 |
| Sentence: | "We investigated the effects of DSF on human O(6)-methylguanine-DNA methyltransferase (MGMT), a DNA repair protein and chemotherapy target that removes the mutagenic O(6)-akyl groups from guanines, and thus confers resistance to alkylating agents in brain tumors. We used DSF, copper-chelated DSF or CuCl2-DSF combination and found that all treatments inhibited the MGMT activity in two brain tumor cell lines in a rapid and dose-dependent manner." |
Sequence & Structure:
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
