Id: acc3298
Group: 2sens
Protein: 4EBP1?
Gene Symbol: Eif4ebp1
Protein Id: Q62622
Protein Name: 4EBP1_RAT
PTM: phosphorylation
Site: Thr70
Site Sequence: CRNSPVAKTPPKDLPTIPGVT
Disease Category: Nervous system diseases
Disease: Parkinson's Disease
Disease Subtype: neuronal cell death
Disease Cellline: PC12
Disease Info:
Drug: "6-hydroxydopamine,N-methyl-4-phenylpyridine,rotenone"
Drug Info: "The <|Drug|> includes 6 - hydroxydopamine, N - methyl - 4 - phenylpyridine and rotenone, which are likely to have relevance in certain pharmacological or biological research."
Effect: modulate
Effect Info: "In PC12 cells and primary neurons, PD-related toxins (6-OHDA, MPP+, rotenone) inhibit the phosphorylation of mTOR, S6K1, and 4E-BP1, leading to decreased cell viability and activation of apoptotic proteins, which triggers neuronal cell death."
Note:
Score: 4.0
Pubmed(PMID): 24726895
Sentence Index:
Sentence:

Sequence & Structure:

MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPTIPGVTSPTSDEPPMQASQSHLHSSPEDKRAGGEESQFEMDI

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: