Id: | acc3298 |
Group: | 2sens |
Protein: | 4EBP1? |
Gene Symbol: | Eif4ebp1 |
Protein Id: | Q62622 |
Protein Name: | 4EBP1_RAT |
PTM: | phosphorylation |
Site: | Thr70 |
Site Sequence: | CRNSPVAKTPPKDLPTIPGVT |
Disease Category: | Nervous system diseases |
Disease: | Parkinson's Disease |
Disease Subtype: | neuronal cell death |
Disease Cellline: | PC12 |
Disease Info: | |
Drug: | "6-hydroxydopamine,N-methyl-4-phenylpyridine,rotenone" |
Drug Info: | "The <|Drug|> includes 6 - hydroxydopamine, N - methyl - 4 - phenylpyridine and rotenone, which are likely to have relevance in certain pharmacological or biological research." |
Effect: | modulate |
Effect Info: | "In PC12 cells and primary neurons, PD-related toxins (6-OHDA, MPP+, rotenone) inhibit the phosphorylation of mTOR, S6K1, and 4E-BP1, leading to decreased cell viability and activation of apoptotic proteins, which triggers neuronal cell death." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 24726895 |
Sentence Index: | 24726895_4-5 |
Sentence: | "Here, we show that PD mimetics (6-hydroxydopamine, N-methyl-4-phenylpyridine or rotenone) suppressed phosphorylation of mTOR, S6K1 and 4E-BP1, reduced cell viability, and activated caspase-3 and PARP in PC12 cells and primary neurons. Overexpression of wild-type mTOR or constitutively active S6K1, or downregulation of 4E-BP1 in PC12 cells partially prevented cell death in response to the PD toxins, revealing that mTOR-mediated S6K1 and 4E-BP1 pathways due to the PD toxins were inhibited, leading to neuronal cell death." |
Sequence & Structure:
MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPTIPGVTSPTSDEPPMQASQSHLHSSPEDKRAGGEESQFEMDI
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.