| Id: | acc3317 |
| Group: | 2sens |
| Protein: | p65 |
| Gene Symbol: | Rela |
| Protein Id: | P58546 |
| Protein Name: | MTPN_HUMAN |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Respiratory system diseases |
| Disease: | Acute Lung Injury |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Magnolol |
| Drug Info: | "Magnolol is a bioactive compound found in Magnolia officinalis. It has various potential health benefits, such as anti - inflammatory and antioxidant properties. " |
| Effect: | modulate |
| Effect Info: | "Magnolol inhibited the LPS-induced expression of p-p38, p-IκB-α, and p-p65 NF-κB in a dose-dependent manner, possibly by suppressing NF-κB activation through a PPAR-γ-dependent mechanism." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 26072062 |
| Sentence Index: | 26072062_4-5 |
| Sentence: | "The aim of this study was to explore the involvement of PPAR-gamma in the beneficial effect of magnolol in lipopolysaccharide (LPS)-induced ALI. We found that treatment with magnolol greatly improved the pathological features of ALI evidenced by reduction of lung edema, polymorphonuclear neutrophil infiltration, ROS production, the levels of pro-inflammatory cytokines in bronchoalveolar lavage fluid (BALF), the expression of iNOS and COX-2, and NF-kappaB activation in lungs exposed to LPS." |
Sequence & Structure:
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
