| Id: | acc3320 |
| Group: | 2sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63086 |
| Protein Name: | MK01_RAT |
| PTM: | phosphorylation |
| Site: | Thr185 |
| Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Cardiac Injury |
| Disease Subtype: | the 5/6 subtotal nephrectomy rats mimicked type 4 |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | apocynin |
| Drug Info: | Apocynin is a naturally - occurring compound that has been studied for its potential anti - inflammatory and antioxidant properties. |
| Effect: | modulate |
| Effect Info: | Apocynin alleviates oxidative stress-induced myocardial hypertrophy and fibrosis in a 5/6 nephrectomy rat model by inhibiting the phosphorylation of myocardial ERK1/2 and improves cardiac function in type 4 cardiorenal syndrome. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 26109504 |
| Sentence Index: | 26109504_8-9 |
| Sentence: | "These changes were significantly attenuated by apocynin. In vitro study showed that apocynin reduced angiotensin II-induced NADPH oxidase-dependent oxidative stress, upregulation of fibroblast growth factor-2 and fibrosis biomarkers, and ERK1/2 phosphorylation in cardiac fibroblasts." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
| Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
