| Id: | acc3324 |
| Group: | 2sens |
| Protein: | cav-1 |
| Gene Symbol: | Cav1 |
| Protein Id: | P49817 |
| Protein Name: | CAV1_MOUSE |
| PTM: | phosphorylation |
| Site: | Tyr14 |
| Site Sequence: | KYVDSEGHLYTVPIREQGNIY |
| Disease Category: | Immune system diseases |
| Disease: | Microphage?Apoptosis |
| Disease Subtype: | |
| Disease Cellline: | macrophage |
| Disease Info: | |
| Drug: | EPS |
| Drug Info: | "EPS is a drug that may be used for specific medical purposes, though more context is needed for a detailed description." |
| Effect: | modulate |
| Effect Info: | Bordetella exopolysaccharide (EPS) can reduce apoptosis of mouse peritoneal macrophages induced by high glucose and promote caveolin–1 phosphorylation by regulating the interaction between caveolin–1 and TLR4. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 26424181 |
| Sentence Index: | 26424181_7-8 |
| Sentence: | "Glut1 level to accelerate glucose consumption, which should be the reason for protective effect of EPS on macrophage exposed to high glucose. Further investigation demonstrated that TLR4-dependent caveolin-1 phosphorylation induced by EPS promoted association of caveolin-1 with TLR4, which should be critical for activation of TLR4 signaling pathway." |
Sequence & Structure:
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
