| Id: | acc3330 |
| Group: | 2sens |
| Protein: | Rab8A |
| Gene Symbol: | RAB8A |
| Protein Id: | P61006 |
| Protein Name: | RAB8A_HUMAN |
| PTM: | phosphorylation |
| Site: | Ser111 |
| Site Sequence: | WIRNIEEHASADVEKMILGNK |
| Disease Category: | Nervous system diseases |
| Disease: | Parkinson's Disease |
| Disease Subtype: | |
| Disease Cellline: | HEK293 |
| Disease Info: | |
| Drug: | PINK1 |
| Drug Info: | "PINK1 is not a drug. It is a gene, also known as PTEN-induced kinase 1, which encodes a protein associated with mitochondrial function and is linked to Parkinson's disease." |
| Effect: | modulate |
| Effect Info: | "Activation of PINK1 can specifically induce phosphorylation at the Ser111 site of members of the Rab protein family (Rab8A, Rab8B, Rab13). This PTM is inhibited in HeLa cells lacking PINK1 and fibroblasts derived from Parkinson's disease patients with PINK1 mutations, indicating that phosphorylation at Ser111 is dependent on the function of PINK1." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 26471730 |
| Sentence Index: | 26471730_7-8 |
| Sentence: | "Using phospho-specific antibodies raised against Ser(111) of each of the Rabs, we demonstrate that Rab Ser(111) phosphorylation occurs specifically in response to PINK1 activation and is abolished in HeLa PINK1 knockout cells and mutant PINK1 PD patient-derived fibroblasts stimulated by mitochondrial depolarisation. We provide evidence that Rab8A GTPase Ser(111) phosphorylation is not directly regulated by PINK1 in vitro and demonstrate in cells the time course of Ser(111) phosphorylation of Rab8A, 8B and 13 is markedly delayed compared to phosphorylation of Parkin at Ser(65)." |
Sequence & Structure:
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTAC| RAB8A-Ser111 | |
|---|---|
| Cancer | Intensity |
| BRCA | 1.231 |
| COAD | |
| HGSC | 0.683 |
| ccRCC | |
| GBM | |
| HNSC | -1.25 |
| LUAD | -0.675 |
| LUSC | 0.01 |
| non_ccRCC | |
| PDAC | |
| UCEC | |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
