| Id: | acc3353 |
| Group: | 2sens |
| Protein: | GSK3beta |
| Gene Symbol: | Gsk3b |
| Protein Id: | P18266 |
| Protein Name: | GSK3B_RAT |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Myocardial I/R Injury |
| Disease Subtype: | |
| Disease Cellline: | H9c2 |
| Disease Info: | |
| Drug: | asiatic acid |
| Drug Info: | Asiatic acid is a natural triterpenoid compound that has various biological activities such as anti - inflammatory and antioxidant effects. |
| Effect: | counteract |
| Effect Info: | "Madecassic acid can enhance the phosphorylation of GSK - 3β Ser9, leading to its inactivation, and exert cardioprotective effects by maintaining mitochondrial function and reducing ROS production." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 27657024 |
| Sentence Index: | 27657024_7-8 |
| Sentence: | "In addition, asiatic acid improved mitochondrial function, as evidenced by reduced reactive oxygen species (ROS) accumulation, enhanced mitochondrial membrane potential and decreased intracellular calcium concentration. Using Western blot assay, we found that asiatic acid promoted the phosphorylation of Akt and subsequent inactivation of glycogen synthase kinase-3beta (GSK-3beta), and induced the expression of hypoxia-inducible factor 1alpha (HIF-1alpha) after OGD/R." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
