| Id: | acc3360 |
| Group: | 2sens |
| Protein: | p38 MAPK |
| Gene Symbol: | Mapk14 |
| Protein Id: | P47811 |
| Protein Name: | MK14_MOUSE |
| PTM: | phosphorylation |
| Site: | Tyr182 |
| Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
| Disease Category: | Immune system diseases |
| Disease: | Asthma? |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Caffeic acid phenethyl ester (CAPE) |
| Drug Info: | "Caffeic acid phenethyl ester (CAPE) is a natural compound that has attracted attention for its potential health - promoting properties. It is often studied for its antioxidant, anti - inflammatory and other biological activities. " |
| Effect: | modulate |
| Effect Info: | CAPE inhibits ROS-induced phosphorylation of p38 and alleviates airway inflammatory responses. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 27746262 |
| Sentence Index: | 27746262_10-11 |
| Sentence: | "The phosphorylation of Akt and Mitogen-Activated Protein Kinase (MAPK) caused by increased ROS was significantly decreased by CAPE, which implied a contribution of ROS-MAPK/Akt signaling to the attenuation of asthma. Our findings indicated for the first time that CAPE alleviates airway inflammation and remodeling in chronic asthma by balancing the airway microenvironment, which highlights a novel profile of CAPE as a potent agent for asthma management." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
