PMADS

Id:	acc3370
Group:	2sens
Protein:	PP2A-C
Gene Symbol:	PPP2CA
Protein Id:	P67775
Protein Name:	PP2AA_HUMAN
PTM:	phosphorylation
Site:	Tyr307
Site Sequence:	PHVTRRTPDYFL---------
Disease Category:	Cancer
Disease:	Bladder Cancer
Disease Subtype:
Disease Cellline:	T24T
Disease Info:
Drug:	XIAP KO
Drug Info:	XIAP KO refers to the knockout of the XIAP gene. It is often used in research to study the function of XIAP in various biological processes.
Effect:	modulate
Effect Info:	Phosphorylation of the Tyr307 site in PP2A-C promotes tumor growth.
Note:
Score:	4.0
Pubmed(PMID):	28057023
Sentence Index:	28057023_9-10
Sentence:	"Mechanistic studies indicated that BIR domain activated the protein phosphatase 2 (PP2A) activity by decreasing the phosphorylation of PP2A at Tyr307 in its catalytic subunit, PP2A-C. Such activated PP2A prevented the deviant phosphorylation and activation of MAPK kinases/MAPKs, their downstream effector c-Jun, and in turn inhibiting transcription of c-Jun-regulated the miR-200a. CONCLUSIONS: Our study uncovered a novel function of BIR domain of XIAP in regulating the EGFR translation, providing significant insight into the understanding of the XIAP overexpression in the cancer development and progression, further offering a new theoretical support for using XIAP BIR domain and EGFR as targets for cancer therapy."

Sequence & Structure:

MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

Target	Drug name	MOA	Phase	Status	Disease	Source
PPP2CA	LB-100	Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform inhibitor	2	Completed	glioblastoma multiforme	ClinicalTrials
PPP2CA	LB-100	Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform inhibitor	2	Completed	oligodendroglioma	ClinicalTrials
PPP2CA	LB-100	Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform inhibitor	2	Completed	Paraganglioma	ClinicalTrials
PPP2CA	LB-100	Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform inhibitor	1	Recruiting	myelodysplastic syndrome	ClinicalTrials
PPP2CA	LB-100	Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform inhibitor	1	Recruiting	clear cell adenocarcinoma	ClinicalTrials
PPP2CA	LB-100	Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform inhibitor	1	Recruiting	small cell lung carcinoma	ClinicalTrials
PPP2CA	LB-100	Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform inhibitor	1	Not yet recruiting	colorectal carcinoma	ClinicalTrials
PPP2CA	LB-100	Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform inhibitor	1	Recruiting	soft tissue sarcoma	ClinicalTrials
PPP2CA	LB-100	Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform inhibitor	1	Completed	cancer	ClinicalTrials

Note: Only show clinically investigational or approved drugs with protein targets.

Protein Tractability:

source: Open Targets

Small molecule

Antibody

PROTAC

Other modalities

Approved Drug

Advanced Clinical

Phase 1 Clinical

Structure with Ligand

High-Quality Ligand

High-Quality Pocket

Med-Quality Pocket

Druggable Family

Approved Drug

Advanced Clinical

Phase 1 Clinical

UniProt loc high conf

GO CC high conf

UniProt loc med conf

UniProt SigP or TMHMM

GO CC med conf

Human Protein Atlas loc

Approved Drug

Advanced Clinical

Phase 1 Clinical

Literature

UniProt Ubiquitination

Database Ubiquitination

Half-life Data

Small Molecule Binder

Approved Drug

Advanced Clinical

Phase 1 Clinical

PTM Intensity:

source: CPTAC

No intensity data of this site,
show all other sites!

PPP2CA-Ser24
Cancer	Intensity
BRCA
COAD
HGSC
ccRCC	0.246
GBM
HNSC	-0.671
LUAD	1.308
LUSC
non_ccRCC
PDAC
UCEC	-0.883

PPP2CA-Ser26
Cancer	Intensity
BRCA	-0.506
COAD
HGSC
ccRCC	0.522
GBM
HNSC	0.484
LUAD
LUSC	0.997
non_ccRCC
PDAC
UCEC	-1.497

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links:

CTD
DMRdb