| Id: | acc3382 |
| Group: | 2sens |
| Protein: | IGFBP-1 |
| Gene Symbol: | IGFBP1 |
| Protein Id: | P08833 |
| Protein Name: | IBP1_HUMAN |
| PTM: | phosphorylation |
| Site: | Ser119 |
| Site Sequence: | ASAPHAAEAGSPESPESTEIT |
| Disease Category: | Respiratory system diseases |
| Disease: | Hypoxia |
| Disease Subtype: | |
| Disease Cellline: | HepG2 |
| Disease Info: | |
| Drug: | Rapamycin + Hypoxia |
| Drug Info: | Rapamycin is a macrolide compound with immunosuppressive and anti - aging properties | Hypoxia refers to a condition of low oxygen levels which can have various biological effects. |
| Effect: | no effect |
| Effect Info: | "Hypoxia and rapamycin treatment significantly upregulated the phosphorylation of multiple sites of IGFBP-1, and the mechanism involves the mTOR→CSNK2β→IGFBP-1→IGF-I signaling pathway." |
| Note: | no effect |
| Score: | 2.0 |
| Pubmed(PMID): | 29037858 |
| Sentence Index: | 29037858_9-10 |
| Sentence: | "Stable isotope labeling with multiple reaction monitoring-mass spectrometry demonstrated that hypoxia and rapamycin treatment increased IGFBP-1 phosphorylation at Ser98/Ser101/Ser119/Ser174 but most considerably (106-fold) at Ser169. We report interactions between CSNK-2beta and IGFBP-1 as well as mTOR and CSNK-2beta, providing strong evidence of a mechanistic link between mTOR and IGF-I signaling, two critical regulators of cell growth via CSNK-2." |
Sequence & Structure:
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
