Id: acc3384
Group: 2sens
Protein: IGFBP-1
Gene Symbol: IGFBP1
Protein Id: P08833
Protein Name: IBP1_HUMAN
PTM: phosphorylation
Site: Ser174
Site Sequence: HVTNIKKWKEPCRIELYRVVE
Disease Category: Respiratory system diseases
Disease: Hypoxia
Disease Subtype:
Disease Cellline: HepG2
Disease Info:
Drug: Rapamycin + Hypoxia
Drug Info: Rapamycin is a macrolide compound with immunosuppressive and anti - aging properties | Hypoxia refers to a condition of low oxygen levels which can have various biological effects.
Effect: no effect
Effect Info: "Hypoxia and rapamycin treatment significantly upregulated the phosphorylation of multiple sites of IGFBP-1, and the mechanism involves the mTOR→CSNK2β→IGFBP-1→IGF-I signaling pathway."
Note: no effect
Score: 2.0
Pubmed(PMID): 29037858
Sentence Index:
Sentence:

Sequence & Structure:

MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: