Id: | acc3384 |
Group: | 2sens |
Protein: | IGFBP-1 |
Gene Symbol: | IGFBP1 |
Protein Id: | P08833 |
Protein Name: | IBP1_HUMAN |
PTM: | phosphorylation |
Site: | Ser174 |
Site Sequence: | HVTNIKKWKEPCRIELYRVVE |
Disease Category: | Respiratory system diseases |
Disease: | Hypoxia |
Disease Subtype: | |
Disease Cellline: | HepG2 |
Disease Info: | |
Drug: | Rapamycin + Hypoxia |
Drug Info: | Rapamycin is a macrolide compound with immunosuppressive and anti - aging properties | Hypoxia refers to a condition of low oxygen levels which can have various biological effects. |
Effect: | no effect |
Effect Info: | "Hypoxia and rapamycin treatment significantly upregulated the phosphorylation of multiple sites of IGFBP-1, and the mechanism involves the mTOR→CSNK2β→IGFBP-1→IGF-I signaling pathway." |
Note: | no effect |
Score: | 2.0 |
Pubmed(PMID): | 29037858 |
Sentence Index: | 29037858_9-10 |
Sentence: | "Stable isotope labeling with multiple reaction monitoring-mass spectrometry demonstrated that hypoxia and rapamycin treatment increased IGFBP-1 phosphorylation at Ser98/Ser101/Ser119/Ser174 but most considerably (106-fold) at Ser169. We report interactions between CSNK-2beta and IGFBP-1 as well as mTOR and CSNK-2beta, providing strong evidence of a mechanistic link between mTOR and IGF-I signaling, two critical regulators of cell growth via CSNK-2." |
Sequence & Structure:
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.