Id: | acc3387 |
Group: | 2sens |
Protein: | hnRNPA1 |
Gene Symbol: | HNRNPA1 |
Protein Id: | P09651 |
Protein Name: | ROA1_HUMAN |
PTM: | phosphorylation |
Site: | Ser6 |
Site Sequence: | ----MSKSESPKEPEQLRKLF |
Disease Category: | Cancer |
Disease: | Colorectal Cancer |
Disease Subtype: | |
Disease Cellline: | HCT116 |
Disease Info: | |
Drug: | S6K2 |
Drug Info: | S6K2 is a drug that may play a role in certain biological processes and could be a target for specific medical treatments. |
Effect: | modulate |
Effect Info: | Phosphorylation of Ser6 in hnRNPA1 by S6K2 regulates glucose metabolism and cell growth in colorectal cancer. |
Note: | Non-conventional drugs |
Score: | 3.0 |
Pubmed(PMID): | 29344170 |
Sentence Index: | 29344170_7-8 |
Sentence: | "In addition, chromatin immunoprecipitation assay indicated that S6K2 phosphorylation of Ser6 of hnRNPA1 facilitated hnRNPA1 binding to the splicing site of the PKM gene. As a result, cancer cells preferentially expressed the PKM2 isoform, instead of the PKM1 isoform." |
Sequence & Structure:
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACHNRNPA1-Ser6 | |
---|---|
Cancer | Intensity |
BRCA | -2.235 |
COAD | -0.271 |
HGSC | -0.25 |
ccRCC | 0.236 |
GBM | -0.565 |
HNSC | 0.512 |
LUAD | -0.268 |
LUSC | 0.232 |
non_ccRCC | 1.964 |
PDAC | 0.471 |
UCEC | 0.175 |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.