| Id: | acc3483 |
| Group: | 2sens |
| Protein: | p38 |
| Gene Symbol: | Mapk14 |
| Protein Id: | P47811 |
| Protein Name: | MK14_MOUSE |
| PTM: | phosphorylation |
| Site: | Thr180 |
| Site Sequence: | LARHTDDEMTGYVATRWYRAP |
| Disease Category: | Immune system diseases |
| Disease: | Inflammatory |
| Disease Subtype: | Inflammatory Bowel Disease |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | decitabine |
| Drug Info: | Decitabine is a hypomethylating agent used in the treatment of myelodysplastic syndromes and other hematological malignancies. |
| Effect: | modulate |
| Effect Info: | "Decitabine can increase the levels of zonular occludens-1 and occludin, inhibit the phosphorylation of ERK1/2, JNK and p38, and relieve DSS-induced colonic barrier dysfunction, weight loss, mucus and bloody stools in mice." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 32468024 |
| Sentence Index: | 32468024_8-9 |
| Sentence: | "Furthermore, decitabine increased the levels of zonular occludens-1 and occludin, and inhibited the phosphorylation of ERK1/2, JNK and p38. In conclusion, the present study suggested that decitabine could alleviate DSS-induced impaired colon barrier and the weight loss, mucus and bloody stools in mice by releasing the inhibitory factor IL-10, reducing the pro-inflammatory factor IL-17, activating CD4+ Foxp3+ T cells and inhibiting the activation of the MAPK pathway." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
