Id: acc3491
Group: 2sens
Protein: ERK2
Gene Symbol: Mapk1
Protein Id: P63085
Protein Name: MK01_MOUSE
PTM: phosphorylation
Site: Tyr187
Site Sequence: HTGFLTEYVATRWYRAPEIML
Disease Category: Cardiovascular and circulatory system diseases
Disease: Abdominal Aortic Aneurysm
Disease Subtype: angiotensin II- (AngII-) induced
Disease Cellline:
Disease Info:
Drug: simvastatin
Drug Info: Simvastatin is a lipid - lowering drug commonly used to reduce cholesterol levels and decrease the risk of cardiovascular diseases.
Effect: modulate
Effect Info: "AngII induces enhanced ERK phosphorylation, promoting inflammation and vascular wall remodeling. Simvastatin can significantly inhibit ERK phosphorylation and slow down the formation of AAA."
Note:
Score: 4.0
Pubmed(PMID): 32617140
Sentence Index:
Sentence:

Sequence & Structure:

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - D EL4 thymoma Phosphorylation 10753946
T 183 U Mammary tumor/carcinoma Phosphorylation 12754301
T 188 U Heart failure Phosphorylation 19060905

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: