Id: acc3510
Group: 2sens
Protein: MEK1
Gene Symbol: Map2k1
Protein Id: Q01986
Protein Name: MP2K1_RAT
PTM: phosphorylation
Site: Ser217
Site Sequence: DFGVSGQLIDSMANSFVGTRS
Disease Category: Endocrine and metabolic diseases
Disease: Diabetes Mellitus
Disease Subtype: Diabetic Nephropathy
Disease Cellline:
Disease Info:
Drug: S-allylcysteine (SAC)
Drug Info: "S-allylcysteine (SAC) is a natural compound found in garlic with potential health benefits, such as antioxidant and anti - inflammatory properties."
Effect: modulate
Effect Info: "SAC significantly reduced the levels of thirst, polyuria, hyperphagia, urinary protein, and multiple renal injury biomarkers, and effectively decreased the phosphorylation of the MEK1/2–ERK1/2–RSK2 signaling pathway, with effects similar to those of metformin."
Note:
Score: 4.0
Pubmed(PMID): 32862702
Sentence Index:
Sentence:

Sequence & Structure:

MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: