| Id: | acc3513 |
| Group: | 2sens |
| Protein: | MEK2 |
| Gene Symbol: | Map2k2 |
| Protein Id: | P36506 |
| Protein Name: | MP2K2_RAT |
| PTM: | phosphorylation |
| Site: | Ser217 |
| Site Sequence: | IKLCDFGVSGQLIDSMANSFV |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | Diabetic Nephropathy |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Metformin |
| Drug Info: | "Metformin is a widely - used oral medication for treating type 2 diabetes, which helps control blood sugar levels." |
| Effect: | modulate |
| Effect Info: | "SAC significantly reduced the levels of thirst, polyuria, hyperphagia, urinary protein, and multiple renal injury biomarkers, and effectively decreased the phosphorylation of the MEK1/2–ERK1/2–RSK2 signaling pathway, with effects similar to those of metformin." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 32862702 |
| Sentence Index: | 32862702_2-3 |
| Sentence: | "METHODS: DN rats were orally supplemented with SAC (150 mg/kg body weight) for a period of 45 days and the effect of SAC on urinary albumin excretion, metabolic parameters, and tubular injury biomarkers by ELISA, total levels and phosphorylation of MEK1/2, ERK1/2, and RSK2 by western blotting analysis in control and experimental rats were assessed. RESULTS: From this study, we observed that SAC considerably decreased polydipsia, poly urea, polyphagia, albuminuria and the levels of urinary N-acetyl-beta-D-glucosaminidase, neutrophil gelatinase-associated lipocalin, transforming growth factor-beta1 and SAC effectively altered the pathological changes in DN rats." |
Sequence & Structure:
MLARRKPVLPALTINPTIAEGPSPTSEGASEAHLVDLQKKLEELDLDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERADLKLLTNHAFIKRSEGEDVDFAGWLCRTLRLKQPSTPTRTAV
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
