| Id: | acc3574 |
| Group: | 2sens |
| Protein: | histone H3 |
| Gene Symbol: | H3c1 |
| Protein Id: | P68433 |
| Protein Name: | H31_MOUSE |
| PTM: | acetylation |
| Site: | Lys27 |
| Site Sequence: | RKQLATKAARKSAPATGGVKK |
| Disease Category: | Cancer |
| Disease: | Osteosarcoma |
| Disease Subtype: | |
| Disease Cellline: | "MG63,U2OS" |
| Disease Info: | |
| Drug: | levobupivacaine |
| Drug Info: | Levobupivacaine is a long - acting local anesthetic commonly used for nerve block and infiltration anesthesia. |
| Effect: | modulate |
| Effect Info: | Bupivacaine can inhibit the acetylation level of MAFB by reducing the expression of KAT5. This reduction in PTM has a positive impact on the efficacy of levobupivacaine in the treatment of osteosarcoma. |
| Note: | histone |
| Score: | 3.0 |
| Pubmed(PMID): | 35333774 |
| Sentence Index: | 35333774_7-8 |
| Sentence: | "Regarding mechanism, we identified that levobupivacaine inhibited MAFB and KAT5 expression in osteosarcoma cells. We observed that lysine acetyltransferase 5 could enriched in the promoter region of MAF BZIP transcription factor B, while levobupivacaine treatment could repressed the enrichment." |
Sequence & Structure:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
