| Id: | acc3580 |
| Group: | 2sens |
| Protein: | MIF |
| Gene Symbol: | Mif?? |
| Protein Id: | P34884 |
| Protein Name: | MIF_MOUSE |
| PTM: | acetylation |
| Site: | Lys78 |
| Site Sequence: | GGAQNRNYSKLLCGLLSDRLH |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Ischemic Stroke |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | HDAC6 inhibitor + aspirin |
| Drug Info: | HDAC6 inhibitor is a type of drug that inhibits the activity of HDAC6 enzyme | Aspirin is a well - known non - steroidal anti - inflammatory drug. |
| Effect: | modulate |
| Effect Info: | "HDAC6 inhibitors and aspirin can promote the acetylation of MIF at the K78 site, block its interaction with AIF, inhibit its nuclear translocation, thereby reducing neuronal DNA fragmentation and cell death, and exerting a protective effect against cerebral ischemia." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 35585040 |
| Sentence Index: | 35585040_4-5 |
| Sentence: | "Here, we discovered that genetic ablation or pharmacological inhibition of HDAC6 reduced brain injury after ischemic stroke by increasing macrophage migration inhibitory factor (MIF) acetylation. Mass spectrum analysis and biochemical results revealed that HDAC6 inhibitor or aspirin treatment promoted MIF acetylation on the K78 residue." |
Sequence & Structure:
MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
