Id: | acc3586 |
Group: | 2sens |
Protein: | MCL-1 |
Gene Symbol: | MCL1 |
Protein Id: | Q07820 |
Protein Name: | MCL1_HUMAN |
PTM: | phosphorylation |
Site: | Thr161 |
Site Sequence: | NNTSTDGSLPSTPPPAEEEED |
Disease Category: | Cancer |
Disease: | Leukemia |
Disease Subtype: | Acute Myeloid Leukemia |
Disease Cellline: | |
Disease Info: | |
Drug: | Venetoclax + Gilteritinib |
Drug Info: | Venetoclax is a drug used in certain cancer treatments | Gilteritinib is also a medication that plays a role in treating specific types of cancers. |
Effect: | modulate |
Effect Info: | Decreased phosphorylation of Thr161 weakens the stability of MCL-1 and enhances its tendency to degrade. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 35857899 |
Sentence Index: | 35857899_10-11 |
Sentence: | "MCL-1 downregulation was associated with increased MCL-1 phosphorylation of serine 159, decreased phosphorylation of threonine 161 and proteasomal degradation. Gilteritinib and venetoclax were active in a FLT3 wildtype AML PDX model with TP53 mutation and reduced leukemic burden in four FLT3 wildtype AML patients receiving venetoclax-gilteritinib off-label after developing refractory disease under venetoclax-azacitidine." |
Sequence & Structure:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 3 | Withdrawn | small cell lung carcinoma | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 3 | Withdrawn | small cell lung carcinoma | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 2 | Completed | Hodgkins lymphoma | ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 2 | Completed | Hodgkins lymphoma | ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 2 | Completed | myelodysplastic syndrome | ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 2 | Completed | acute myeloid leukemia | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 2 | Completed | myelodysplastic syndrome | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 2 | Completed | follicular lymphoma | ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 2 | Completed | follicular lymphoma | ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 2 | Completed | myelofibrosis | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 2 | Completed | myelofibrosis | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Completed | chronic lymphocytic leukemia | ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Completed | chronic lymphocytic leukemia | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Terminated | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Terminated | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Terminated | diffuse large B-cell lymphoma | ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Terminated | diffuse large B-cell lymphoma | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Completed | small cell lung carcinoma | ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Completed | small cell lung carcinoma | ClinicalTrials ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Terminated | multiple myeloma | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Terminated | multiple myeloma | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Completed | lymphoid neoplasm | ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Completed | lymphoid neoplasm | ClinicalTrials |
MCL1 | OBATOCLAX | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Terminated | metastatic melanoma | ClinicalTrials |
MCL1 | OBATOCLAX MESYLATE | Induced myeloid leukemia cell differentiation protein Mcl-1 inhibitor | 1 | Terminated | metastatic melanoma | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
MCL1-Ser121 | |
---|---|
Cancer | Intensity |
BRCA | 1.735 |
COAD | -0.363 |
HGSC | |
ccRCC | -0.848 |
GBM | |
HNSC | |
LUAD | -0.245 |
LUSC | -0.279 |
non_ccRCC | |
PDAC | |
UCEC |
MCL1-Ser150 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | -0.363 |
GBM | 1.584 |
HNSC | 0.338 |
LUAD | -0.901 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | -0.658 |
MCL1-Ser159 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | -0.489 |
HGSC | |
ccRCC | -1.174 |
GBM | |
HNSC | 0.807 |
LUAD | 0.856 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
MCL1-Ser162 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | -1.323 |
HGSC | -0.231 |
ccRCC | -0.964 |
GBM | 1.077 |
HNSC | 0.909 |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | 0.532 |
MCL1-Ser60 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | -1.244 |
ccRCC | -0.375 |
GBM | |
HNSC | 0.132 |
LUAD | -0.028 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | 1.515 |
MCL1-Ser64 | |
---|---|
Cancer | Intensity |
BRCA | 0.434 |
COAD | |
HGSC | -2.572 |
ccRCC | 0.115 |
GBM | 0.309 |
HNSC | 0.671 |
LUAD | 0.439 |
LUSC | 0.663 |
non_ccRCC | -0.059 |
PDAC | |
UCEC | 0 |
MCL1-Thr163 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | -1.014 |
HGSC | 0.029 |
ccRCC | |
GBM | 0.985 |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.