| Id: | acc3589 |
| Group: | 2sens |
| Protein: | PPARgamma |
| Gene Symbol: | Pparg |
| Protein Id: | P37238 |
| Protein Name: | PPARG_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser273 |
| Site Sequence: | ILTGKTTDKSPFVIYDMNSLM |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | helical peptide segments from the LXXLL motif region |
| Drug Info: | "The drug consists of helical peptide segments derived from the LXXLL motif region, which may have specific biological functions related to the LXXLL motif." |
| Effect: | no effect |
| Effect Info: | Block the transcriptional activity of PPARγ by targeting the co - activator binding site (rather than Ser273 or the ligand - binding site). Its action has no direct molecular interaction with Ser273 phosphorylation. |
| Note: | no effect |
| Score: | 2.0 |
| Pubmed(PMID): | 36057906 |
| Sentence Index: | 36057906_1-2 |
| Sentence: | "Peroxisome proliferator-activated receptor gamma (PPARgamma) is a ligand-activated transcription factor belonging to the nuclear hormone receptor and has been exploited as a well-established druggable target for the treatment of diabetes mellitus (DM). Traditionally, small-molecule compounds have been developed to attack at the ligand site and Ser273 phosphorylation site of PPARgamma." |
Sequence & Structure:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| S | 273 | U | Hepatitis | Phosphorylation | 30008738 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
