PMADS

Id:	acc3607
Group:	2sens
Protein:	p38 MAPK
Gene Symbol:	Mapk14
Protein Id:	P47811
Protein Name:	MK14_MOUSE
PTM:	phosphorylation
Site:	Thr180
Site Sequence:	LARHTDDEMTGYVATRWYRAP
Disease Category:	Digestive system diseases
Disease:	Colitis
Disease Subtype:
Disease Cellline:
Disease Info:
Drug:	GPS extract
Drug Info:	GPS extract is a drug. It can potentially be used for relevant medical purposes.
Effect:	modulate
Effect Info:	Drug (GPS extract) → Inhibition of protein phosphorylation (Akt/p38/ERK/JNK) → Alleviation of colitis
Note:
Score:	4.0
Pubmed(PMID):	37249930
Sentence Index:	37249930_9-10
Sentence:	"Network pharmacology integrated with experimental validation identified that GPS extract significantly suppressed Akt, p38, ERK, and JNK phosphorylation in vivo and in vitro, and luteolin, apocynin, caffeic acid, caffeic acid methyl ester, luteoloside, picroside II, aucubin, cinnamic acid, vanillic acid, and sweroside were the main components responsible for the anti-inflammatory effect of GPS. These findings demonstrate that the potential anti-inflammatory effect of GPS extract against colitis is achieved through suppressing PI3K/Akt and MAPK pathways, and that the abovementioned active components mainly exerted its anti-inflammatory effect."

Sequence & Structure:

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links:

CTD
DMRdb