| Id: | acc3610 |
| Group: | 2sens |
| Protein: | GSK3beta |
| Gene Symbol: | Gsk3b |
| Protein Id: | Q9WV60 |
| Protein Name: | GSK3B_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
| Disease Category: | Other |
| Disease: | Pigmentation |
| Disease Subtype: | |
| Disease Cellline: | B16F10 |
| Disease Info: | |
| Drug: | 6-methylcoumarin |
| Drug Info: | 6 - methylcoumarin is a chemical compound that may have certain biological activities and potential applications in the field of pharmacology. |
| Effect: | modulate |
| Effect Info: | "6-Methylcoumarin stimulates melanin production and influences the pigmentation process by activating the phosphorylation of GSK3β and β-catenin, thereby reducing the level of β-catenin. This process may provide clues to the mechanism by which 6-methylcoumarin regulates skin pigmentation." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 37299026 |
| Sentence Index: | 37299026_7-8 |
| Sentence: | "In addition, the 6-methylcoumarin activated GSK3beta and beta-catenin phosphorylation and reduced the beta-catenin protein level. These results suggest that 6-methylcoumarin stimulates melanogenesis through the GSK3beta/beta-catenin signal pathway, thereby affecting the pigmentation process." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
