| Id: | acc3632 |
| Group: | 1sens |
| Protein: | myosin light chain 20 |
| Gene Symbol: | MYL2 |
| Protein Id: | P24844 |
| Protein Name: | MYL9_HUMAN |
| PTM: | phosphorylation |
| Site: | Thr18 |
| Site Sequence: | KTTKKRPQRATSNVFAMFDQS |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Subarachnoid Hemorrhage |
| Disease Subtype: | Subarachnoid Hemorrhage-Related Vasospasm |
| Disease Cellline: | SM-3 |
| Disease Info: | |
| Drug: | Fasudil |
| Drug Info: | "Fasudil is a drug used in medical treatment, which may have effects on certain physiological processes." |
| Effect: | modulate |
| Effect Info: | "Fasudil reduces the phosphorylation level of myosin by inhibiting related kinases (such as MLCK and ROCK), thus alleviating or preventing the vasospasm caused by subarachnoid hemorrhage from a mechanistic perspective." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 10448094 |
| Sentence Index: | 10448094_3 |
| Sentence: | "Fasudil is an inhibitor of protein kinases, including myosin light chain kinase and Rho associated kinase, thereby inhibiting myosin phosphorylation, and it has been clinically used to prevent vasospasm following subarachnoid hemorrage." |
Sequence & Structure:
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
No data.
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
