| Id: | acc3643 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63086 |
| Protein Name: | MK01_RAT |
| PTM: | phosphorylation |
| Site: | Thr187 |
| Site Sequence: | HTGFLTEYVATRWYRAPEIML |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Vascular Injury |
| Disease Subtype: | |
| Disease Cellline: | VSMCs |
| Disease Info: | |
| Drug: | Bradykinin |
| Drug Info: | "Bradykinin is a peptide that causes blood vessels to dilate, and it plays a role in the inflammatory response." |
| Effect: | modulate |
| Effect Info: | "Tyrosine phosphorylation (PTM) of p42mapk and p44mapk is activated by bradykinin (Drug)-induced ROS generation, promoting c-fos transcription and VSMC proliferation in vascular injury-related diseases (Disease)." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 10775566 |
| Sentence Index: | 10775566_8 |
| Sentence: | These findings demonstrate that the phosphorylation of cytosolic and nuclear p42(mapk) and p44(mapk) and the expression of c-fos mRNA in VSMCs in response to bradykinin are mediated via the generation of ROS and implicate ROS as important mediators in the signal transduction pathway through which bradykinin promotes VSMC proliferation in states of vascular injury. |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | A | Basophilic leukemia | Phosphorylation | 11971018 |
| T | 183 | D | Major depressive disorder | Phosphorylation | 16959794 |
| Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
| T | 183 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
| Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
