| Id: | acc3644 |
| Group: | 1sens |
| Protein: | Bcl-2 |
| Gene Symbol: | BCL2 |
| Protein Id: | P10415 |
| Protein Name: | BCL2_HUMAN |
| PTM: | phosphorylation |
| Site: | ser70 |
| Site Sequence: | ASRDPVARTSPLQTPAAPGAA |
| Disease Category: | Cancer |
| Disease: | Pancreatic Cancer |
| Disease Subtype: | Pancreatic Carcinoma |
| Disease Cellline: | AsPC–1 |
| Disease Info: | |
| Drug: | medroxyprogesterone acetate (MPA) |
| Drug Info: | Medroxyprogesterone acetate (MPA) is a synthetic progestin commonly used in hormonal therapies and contraceptives. |
| Effect: | modulate |
| Effect Info: | "Medroxyprogesterone acetate regulates the anti - apoptotic activity of Bcl - 2 protein by inducing its phosphorylation, promotes the apoptosis of pancreatic cancer cells, and then inhibits the growth of cancer cells." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 10813710 |
| Sentence Index: | 10813710_0 |
| Sentence: | Medroxyprogesterone acetate inhibits human pancreatic carcinoma cell growth by inducing apoptosis in association with Bcl-2 phosphorylation. |
Sequence & Structure:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Select PDB:
| Target | Drug name | MOA | Phase | Status | Disease | Source |
|---|---|---|---|---|---|---|
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | - | chronic lymphocytic leukemia | EMA DailyMed FDA |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | Not yet recruiting | chronic lymphocytic leukemia | ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | - | neoplasm | ATC |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Not yet recruiting | chronic lymphocytic leukemia | ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Not yet recruiting | acute myeloid leukemia | ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | myelodysplastic syndrome | ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Terminated | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | childhood acute myeloid leukemia | ClinicalTrials |
| BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | cutaneous melanoma | ClinicalTrials |
| BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | leukemia | ClinicalTrials |
| BCL2 | OBATOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Withdrawn | small cell lung carcinoma | ClinicalTrials |
| BCL2 | OBATOCLAX MESYLATE | Apoptosis regulator Bcl-2 inhibitor | 3 | Withdrawn | small cell lung carcinoma | ClinicalTrials |
| BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | multiple myeloma | ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | multiple myeloma | ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | multiple myeloma | ClinicalTrials |
| BCL2 | NAVITOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | primary myelofibrosis | ClinicalTrials ClinicalTrials |
| BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Withdrawn | lymphoid leukemia | ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | Mantle cell lymphoma | ClinicalTrials |
| BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | cancer | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
| BCL2L11-Ser104 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | 0.707 | ||||
| ccRCC | |||||
| GBM | |||||
| HNSC | |||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | -0.707 | ||||
| BCL2L11-Ser118 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | 0.707 | ||||
| ccRCC | |||||
| GBM | |||||
| HNSC | -0.707 | ||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L11-Ser77 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | -1.869 | ||||
| COAD | |||||
| HGSC | 1.655 | ||||
| ccRCC | 0.169 | ||||
| GBM | |||||
| HNSC | 0.422 | ||||
| LUAD | 0.134 | ||||
| LUSC | -0.138 | ||||
| non_ccRCC | 0.29 | ||||
| PDAC | |||||
| UCEC | -0.663 | ||||
| BCL2L11-Ser92 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | |||||
| ccRCC | |||||
| GBM | |||||
| HNSC | -0.707 | ||||
| LUAD | 0.707 | ||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L11-Ser93 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | |||||
| ccRCC | |||||
| GBM | |||||
| HNSC | -0.707 | ||||
| LUAD | 0.707 | ||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L11-Ser94 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | -1.664 | ||||
| COAD | |||||
| HGSC | 1.002 | ||||
| ccRCC | -0.246 | ||||
| GBM | |||||
| HNSC | -0.477 | ||||
| LUAD | 0.629 | ||||
| LUSC | -0.105 | ||||
| non_ccRCC | 1.47 | ||||
| PDAC | |||||
| UCEC | -0.61 | ||||
| BCL2L12-Ser113 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | -0.987 | ||||
| COAD | |||||
| HGSC | |||||
| ccRCC | -0.026 | ||||
| GBM | |||||
| HNSC | |||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | 1.013 | ||||
| BCL2L12-Ser121 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | -1.134 | ||||
| COAD | |||||
| HGSC | 1.006 | ||||
| ccRCC | 0.652 | ||||
| GBM | |||||
| HNSC | |||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | -0.524 | ||||
| BCL2L12-Ser194 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | |||||
| ccRCC | |||||
| GBM | |||||
| HNSC | 0.153 | ||||
| LUAD | 0.915 | ||||
| LUSC | -1.068 | ||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L12-Ser195 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | 0.374 | ||||
| COAD | |||||
| HGSC | |||||
| ccRCC | -1.133 | ||||
| GBM | |||||
| HNSC | |||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | 0.759 | ||||
| BCL2L12-Ser241 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | -0.993 | ||||
| HGSC | |||||
| ccRCC | |||||
| GBM | 1.084 | ||||
| HNSC | -0.554 | ||||
| LUAD | 1.075 | ||||
| LUSC | -0.613 | ||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L12-Ser242 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | -0.42 | ||||
| HGSC | -1.185 | ||||
| ccRCC | -0.19 | ||||
| GBM | |||||
| HNSC | 0.276 | ||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | 1.519 | ||||
| BCL2L12-Ser272 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | -0.088 | ||||
| HGSC | |||||
| ccRCC | |||||
| GBM | |||||
| HNSC | 0.237 | ||||
| LUAD | -1.365 | ||||
| LUSC | -0.208 | ||||
| non_ccRCC | |||||
| PDAC | 1.424 | ||||
| UCEC | |||||
| BCL2L12-Ser273 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | 0.524 | ||||
| COAD | |||||
| HGSC | 0.391 | ||||
| ccRCC | -1.495 | ||||
| GBM | |||||
| HNSC | |||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | 0.58 | ||||
| BCL2L12-Thr117 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | 0.35 | ||||
| COAD | |||||
| HGSC | -1.485 | ||||
| ccRCC | 0.687 | ||||
| GBM | |||||
| HNSC | |||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | 0.449 | ||||
| BCL2L13-Ser288 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | |||||
| ccRCC | |||||
| GBM | 0.707 | ||||
| HNSC | |||||
| LUAD | -0.707 | ||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L13-Ser291 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | |||||
| ccRCC | |||||
| GBM | 0.707 | ||||
| HNSC | |||||
| LUAD | -0.707 | ||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L13-Ser312 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | -1.693 | ||||
| COAD | |||||
| HGSC | |||||
| ccRCC | 0.081 | ||||
| GBM | |||||
| HNSC | -0.729 | ||||
| LUAD | |||||
| LUSC | -0.194 | ||||
| non_ccRCC | 1.241 | ||||
| PDAC | 0.345 | ||||
| UCEC | 0.948 | ||||
| BCL2L13-Ser315 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | -1.352 | ||||
| COAD | |||||
| HGSC | 1.857 | ||||
| ccRCC | -0.415 | ||||
| GBM | |||||
| HNSC | -0.336 | ||||
| LUAD | |||||
| LUSC | -0.57 | ||||
| non_ccRCC | 1.042 | ||||
| PDAC | -0.121 | ||||
| UCEC | -0.106 | ||||
| BCL2L13-Ser327 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | 0.707 | ||||
| ccRCC | |||||
| GBM | |||||
| HNSC | -0.707 | ||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L13-Ser329 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | 0.787 | ||||
| ccRCC | -0.543 | ||||
| GBM | |||||
| HNSC | -1.095 | ||||
| LUAD | |||||
| LUSC | -0.447 | ||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | 1.298 | ||||
| BCL2L13-Ser395 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | 0.707 | ||||
| HGSC | -0.707 | ||||
| ccRCC | |||||
| GBM | |||||
| HNSC | |||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L13-Ser420 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | |||||
| ccRCC | |||||
| GBM | 0.707 | ||||
| HNSC | |||||
| LUAD | -0.707 | ||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L13-Ser426 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | |||||
| ccRCC | |||||
| GBM | -0.707 | ||||
| HNSC | |||||
| LUAD | 0.707 | ||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L13-Ser434 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | |||||
| ccRCC | -0.729 | ||||
| GBM | |||||
| HNSC | -0.126 | ||||
| LUAD | |||||
| LUSC | -0.605 | ||||
| non_ccRCC | -0.275 | ||||
| PDAC | 1.735 | ||||
| UCEC | |||||
| BCL2L13-Ser444 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | -2.092 | ||||
| COAD | 0.9 | ||||
| HGSC | -0.546 | ||||
| ccRCC | -0.271 | ||||
| GBM | |||||
| HNSC | -0.516 | ||||
| LUAD | |||||
| LUSC | 0.329 | ||||
| non_ccRCC | 0.352 | ||||
| PDAC | 1.271 | ||||
| UCEC | 0.573 | ||||
| BCL2L13-Ser450 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | -0.476 | ||||
| COAD | 1.017 | ||||
| HGSC | -1.857 | ||||
| ccRCC | -0.033 | ||||
| GBM | |||||
| HNSC | -0.184 | ||||
| LUAD | |||||
| LUSC | -0.52 | ||||
| non_ccRCC | 1.554 | ||||
| PDAC | 0.723 | ||||
| UCEC | -0.225 | ||||
| BCL2L13-Ser453 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | 0.479 | ||||
| HGSC | -1.471 | ||||
| ccRCC | |||||
| GBM | |||||
| HNSC | |||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | 0.735 | ||||
| PDAC | |||||
| UCEC | 0.256 | ||||
| BCL2L13-Ser468 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | -0.707 | ||||
| HGSC | 0.707 | ||||
| ccRCC | |||||
| GBM | |||||
| HNSC | |||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L13-Thr429 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | |||||
| ccRCC | -0.707 | ||||
| GBM | |||||
| HNSC | 0.707 | ||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L13-Thr431 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | |||||
| COAD | |||||
| HGSC | |||||
| ccRCC | -0.707 | ||||
| GBM | |||||
| HNSC | 0.707 | ||||
| LUAD | |||||
| LUSC | |||||
| non_ccRCC | |||||
| PDAC | |||||
| UCEC | |||||
| BCL2L14-Ser135 | |||||
|---|---|---|---|---|---|
| Cancer | Intensity | ||||
| BRCA | -0.901 | ||||
| COAD | 0.578 | ||||
| HGSC | |||||
| ccRCC | |||||
| GBM | |||||
| HNSC | |||||
| LUAD | |||||
| LUSC | -1.232 | ||||
| non_ccRCC | |||||
| PDAC | 0.522 | ||||
| UCEC | 1.032 | ||||
| BCL2L14-Ser44 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | 0.973 |
| HGSC | |
| ccRCC | |
| GBM | |
| HNSC | -1.491 |
| LUAD | |
| LUSC | -0.305 |
| non_ccRCC | |
| PDAC | 0.857 |
| UCEC | -0.034 |
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| S | 70 | A | Cancer | Phosphorylation | 32188705 |
| S | 70 | U | Lung cancer/carcinoma | Phosphorylation | 23514933 |
| S | 70 | U | Prostate cancer | Phosphorylation | 35013120 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
