| Id: | acc3663 |
| Group: | 1sens |
| Protein: | GSK3alpha |
| Gene Symbol: | Gsk3a |
| Protein Id: | P18265 |
| Protein Name: | GSK3A_RAT |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGGGPSGGGPGGSGRARTS |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | islet transplantation |
| Drug Info: | "Islet transplantation is a medical procedure where pancreatic islets are transplanted into a patient, usually to treat type 1 diabetes." |
| Effect: | modulate |
| Effect Info: | "Islet transplantation can correct most of the insulin signaling abnormalities induced by diabetes, such as the phosphorylation levels of insulin receptor, IRS-1, Akt (Ser-473), and GSK-3." |
| Note: | Non-conventional drugs |
| Score: | 3.0 |
| Pubmed(PMID): | 11723053 |
| Sentence Index: | 11723053_2 |
| Sentence: | "The levels of insulin-stimulated tyrosine phosphorylation of the insulin receptor beta-subunit, insulin receptor substrate (IRS)-2, and p52(Shc) were increased in diabetic compared with control heart, whereas tyrosine phosphorylation of IRS-1 was unchanged." |
Sequence & Structure:
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPSGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLIIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRSLGTQLPNNRPLPPLFNFSPGELSIQPSLNAILIPPHLRSPSGPATLTSSSQALTETQTGQDWQAPDATPTLTNSS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
