| Id: | acc3712 |
| Group: | 1sens |
| Protein: | p38 MAP kinase |
| Gene Symbol: | Mapk14 |
| Protein Id: | P70618 |
| Protein Name: | MK14_RAT |
| PTM: | phosphorylation |
| Site: | Tyr182 |
| Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Cardiac Myocyte Dysfunction |
| Disease Subtype: | prenatally stressed (PS) rat |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | SB-203580 |
| Drug Info: | "SB-203580 is a well - known drug often used in biochemical research, especially in studies related to signal transduction pathways." |
| Effect: | modulate |
| Effect Info: | "The p38 mitogen-activated protein (MAP) kinase inhibitor SB-203580 blocked the phosphorylation of p38 MAP kinase, reversed the inhibition of fractional shortening, and partially alleviated the suppressed adrenergic signaling observed in adult rat ventricular myocytes treated with PS + R." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 15465893 |
| Sentence Index: | 15465893_8 |
| Sentence: | "The p38 mitogen-activated protein (MAP) kinase inhibitor SB-203580 blocked p38 MAP kinase phosphorylation, reversed the depression in fractional shortening, and partially ameliorated the blunted adrenergic signaling seen in adult rat ventricular myocytes from PS + R. Phosphorylation of p38 MAP kinase in cardiac myocytes by stress may be sufficient to lead to myocardial dysfunction in animal models and possibly humans." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
