| Id: | acc3713 |
| Group: | 1sens |
| Protein: | MLC20 |
| Gene Symbol: | Myl1 |
| Protein Id: | P02600 |
| Protein Name: | MYL1_RAT |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cancer |
| Disease: | Laryngeal Cancer |
| Disease Subtype: | |
| Disease Cellline: | smooth muscle cell |
| Disease Info: | |
| Drug: | nicotinamide |
| Drug Info: | "Nicotinamide is a form of vitamin B3, commonly used in dermatology for its skin - improving properties and in treating certain medical conditions. " |
| Effect: | no effect |
| Effect Info: | "Nicotinamide inhibits MLC20 phosphorylation, promotes vasodilation, and improves the cellular oxygenation state, thereby enhancing the efficacy of radiotherapy and chemotherapy." |
| Note: | "no effect, ID not sure" |
| Score: | 2.0 |
| Pubmed(PMID): | 15559762 |
| Sentence Index: | 15559762_6 |
| Sentence: | "We conclude that the vasorelaxant effects of nicotinamide are mediated mainly through inhibition of MLC20 phosphorylation, and that this could be a promising target for the development of novel tumor oxygenators to enhance radio- and chemotherapy." |
Sequence & Structure:
MAPKKDVKKPAAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEAFVKHIMSV
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
