| Id: | acc3719 |
| Group: | 1sens |
| Protein: | p38 MAPK |
| Gene Symbol: | Mapk14 |
| Protein Id: | P70618 |
| Protein Name: | MK14_RAT |
| PTM: | phosphorylation |
| Site: | Tyr182 |
| Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
| Disease Category: | Cell stress and damage |
| Disease: | Cell Death |
| Disease Subtype: | Hypoxia |
| Disease Cellline: | H9c2 |
| Disease Info: | |
| Drug: | Rottlerin |
| Drug Info: | Rottlerin is a natural compound that has been studied for its potential biological activities. |
| Effect: | modulate |
| Effect Info: | "Under hypoxic stress conditions, Rottlerin can completely block the phosphorylation and activation of ERK, while significantly enhancing the phosphorylation of p38 MAPK." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 15631696 |
| Sentence Index: | 15631696_6 |
| Sentence: | "Treatment with rottlerin completely blocked the hypoxia-induced ERK phosphorylationation, whereas it significantly increased p38 MAPK phosphorylationation." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
