| Id: | acc3781 |
| Group: | 1sens |
| Protein: | p38 MAP kinase |
| Gene Symbol: | Mapk14 |
| Protein Id: | P70618 |
| Protein Name: | MK14_RAT |
| PTM: | phosphorylation |
| Site: | Thr180 |
| Site Sequence: | LARHTDDEMTGYVATRWYRAP |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Hyperosmotic Stress |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | sorbitol |
| Drug Info: | Sorbitol is a sugar alcohol that can be used as a sweetening agent and a laxative. It is also found in some fruits and vegetables. |
| Effect: | modulate |
| Effect Info: | Sorbitol (sorbitol) induces hyperosmotic stress → ↑ p38 phosphorylation → Activation of stress response pathway (no significant change in JNK phosphorylation) |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 17996851 |
| Sentence Index: | 17996851_3 |
| Sentence: | "Hyperosmotic stress, produced by addition of sorbitol to the incubation buffer, increased p38 phosphorylation; in contrast, JNK phosphorylation was not increased above control levels." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
