Id: | acc3782 |
Group: | 1sens |
Protein: | p38 MAP kinase |
Gene Symbol: | Mapk14 |
Protein Id: | P70618 |
Protein Name: | MK14_RAT |
PTM: | phosphorylation |
Site: | Thr182 |
Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
Disease Category: | Cell stress and damage |
Disease: | Hyperosmotic Stress |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | sorbitol |
Drug Info: | Sorbitol is a sugar alcohol that can be used as a sweetening agent and a laxative. It is also found in some fruits and vegetables. |
Effect: | modulate |
Effect Info: | Sorbitol (sorbitol) induces hyperosmotic stress → ↑ p38 phosphorylation → Activation of stress response pathway (no significant change in JNK phosphorylation) |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 17996851 |
Sentence Index: | 17996851_3 |
Sentence: | "Hyperosmotic stress, produced by addition of sorbitol to the incubation buffer, increased p38 phosphorylation; in contrast, JNK phosphorylation was not increased above control levels." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.