Id: acc3782
Group: 1sens
Protein: p38 MAP kinase
Gene Symbol: Mapk14
Protein Id: P70618
Protein Name: MK14_RAT
PTM: phosphorylation
Site: Thr182
Site Sequence: RHTDDEMTGYVATRWYRAPEI
Disease Category: Cell stress and damage
Disease: Hyperosmotic Stress
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: sorbitol
Drug Info: Sorbitol is a sugar alcohol that can be used as a sweetening agent and a laxative. It is also found in some fruits and vegetables.
Effect: modulate
Effect Info: Sorbitol (sorbitol) induces hyperosmotic stress → ↑ p38 phosphorylation → Activation of stress response pathway (no significant change in JNK phosphorylation)
Note:
Score: 4.0
Pubmed(PMID): 17996851
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: