Id: acc3796
Group: 1sens
Protein: MLC
Gene Symbol: Myl1
Protein Id: P02600
Protein Name: MYL1_RAT
PTM: phosphorylation
Site: Ser19
Site Sequence: PAAAAPAPAPAPAPAPAKPKE
Disease Category: Cardiovascular and circulatory system diseases
Disease: Hypertension
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: telmisartan
Drug Info: "Telmisartan is an angiotensin II receptor blocker used to treat high blood pressure. It helps to relax blood vessels and lower blood pressure, reducing the risk of heart attack and stroke."
Effect: modulate
Effect Info: "Telmisartan improves vascular lesions through bidirectional regulation of phosphorylation events: it activates eNOS phosphorylation to promote vasodilation, and simultaneously inhibits the phosphorylation of myosin light chain (MLC) and MAPK/p70 S6 kinase, thereby alleviating vasoconstriction and fibrotic proliferation respectively."
Note:
Score: 4.0
Pubmed(PMID): 18437150
Sentence Index:
Sentence:

Sequence & Structure:

MAPKKDVKKPAAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEAFVKHIMSV

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: