Id: | acc3819 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63086 |
Protein Name: | MK01_RAT |
PTM: | phosphorylation |
Site: | Thr185 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Arterial Calcinosis |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Erythrocyte-derived depressing factor (EDDF)? |
Drug Info: | Erythrocyte-derived depressing factor (EDDF) is a substance that may have a depressing effect and is derived from erythrocytes. It could potentially play a role in certain physiological or pathological processes. |
Effect: | modulate |
Effect Info: | EDDF inhibits the phosphorylation of ERK1/2 in rats with arterial calcification and improves the function and morphological integrity of vascular smooth muscle cells. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 18992368 |
Sentence Index: | 18992368_6 |
Sentence: | "Blood vessel functions were impaired in rats with arterial calcinosis, as indicated by decreased Ca(2+)-ATPase activity, increased vasoconstrictor responses to alpha1 adrenoceptor agonist phenylephrine and increased ERK1/2 phosphorylation." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.