Id: acc3827
Group: 1sens
Protein: ERK2
Gene Symbol: Mapk1
Protein Id: P63085
Protein Name: MK01_MOUSE
PTM: phosphorylation
Site: Thr185
Site Sequence: HDHTGFLTEYVATRWYRAPEI
Disease Category: Endocrine and metabolic diseases
Disease: Diabetes Mellitus
Disease Subtype: type 1 diabetic
Disease Cellline:
Disease Info:
Drug: Sphingosine-1-phosphate(S1P)?
Drug Info: "Sphingosine-1-phosphate (S1P) is a bioactive lipid mediator involved in various physiological and pathological processes. It plays important roles in cell growth, survival, and immune cell trafficking."
Effect: modulate
Effect Info: One mechanism of the anti - inflammatory effect of S1P in diabetic endothelial cells (ECs) is to inhibit the phosphorylation of ERK1/2 by inducing the expression of MKP - 3 via the S1P - S1P1 receptor axis.
Note:
Score: 4.0
Pubmed(PMID): 19091959
Sentence Index:
Sentence:

Sequence & Structure:

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - D EL4 thymoma Phosphorylation 10753946
T 183 U Mammary tumor/carcinoma Phosphorylation 12754301
T 188 U Heart failure Phosphorylation 19060905

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: