| Id: | acc3827 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63085 |
| Protein Name: | MK01_MOUSE |
| PTM: | phosphorylation |
| Site: | Thr185 |
| Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | type 1 diabetic |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Sphingosine-1-phosphate(S1P)? |
| Drug Info: | "Sphingosine-1-phosphate (S1P) is a bioactive lipid mediator involved in various physiological and pathological processes. It plays important roles in cell growth, survival, and immune cell trafficking." |
| Effect: | modulate |
| Effect Info: | One mechanism of the anti - inflammatory effect of S1P in diabetic endothelial cells (ECs) is to inhibit the phosphorylation of ERK1/2 by inducing the expression of MKP - 3 via the S1P - S1P1 receptor axis. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 19091959 |
| Sentence Index: | 19091959_10 |
| Sentence: | "Incubation of diabetic NOD EC with S1P and the S1P(1)-selective agonist SEW2871 significantly increased expression of MKP-3 and reduced ERK1/2 phosphorylation, while incubation with the S1P(1)/S1P(3) antagonist VPC23019 decreased the expression of MKP-3, both results supporting a role for S1P(1) in MKP-3 regulation." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | D | EL4 thymoma | Phosphorylation | 10753946 |
| T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
| T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
