| Id: | acc3847 |
| Group: | 1sens |
| Protein: | protein 14-3-3 |
| Gene Symbol: | Ywhaz |
| Protein Id: | P63102 |
| Protein Name: | 1433Z_RAT |
| PTM: | phosphorylation |
| Site: | Ser185 |
| Site Sequence: | VFYYEILNSPEKACSLAKTAF |
| Disease Category: | Urinary and reproductive system diseases |
| Disease: | Acute Kidney Injury |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Glutamine? |
| Drug Info: | Glutamine is a non-essential amino acid that plays a crucial role in various physiological processes such as immune function and gut health. |
| Effect: | modulate |
| Effect Info: | "Glutamine plays a renal protective role by inducing the binding of Hsp70 to JNK, inhibiting JNK activation, thereby reducing 14 - 3 - 3 phosphorylation, suppressing Bax translocation and apoptosis." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 19384198 |
| Sentence Index: | 19384198_0 |
| Sentence: | Glutamine attenuates tubular cell apoptosis in acute kidney injury via inhibition of the c-Jun N-terminal kinase phosphorylation of 14-3-3. |
Sequence & Structure:
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
