| Id: | acc3855 |
| Group: | 1sens |
| Protein: | HbA1c |
| Gene Symbol: | HbA1c |
| Protein Id: | P01946 |
| Protein Name: | HBA_RAT |
| PTM: | glycosylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | dihydroxy gymnemic triacetate |
| Drug Info: | "Dihydroxy gymnemic triacetate is a drug, whose specific pharmacological mechanism and application may depend on further research and clinical trials." |
| Effect: | modulate |
| Effect Info: | "Compared with untreated diabetic rats, oral administration of dihydroxytianidol triacetate significantly increased body weight (29.03%) and decreased HbA1c (39.56%)." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 19703537 |
| Sentence Index: | 19703537_6 |
| Sentence: | "An optimum dose of dihydroxy gymnemic triacetate (20mg/kg body weight) was orally administered for 45 days to streptozotocin diabetic rats for the assessment of plasma glucose, insulin, glycated hemoglobin (HbA1c), tissue glycogen, lipid parameters such as triglycerides, total cholesterol, LDL-cholesterol, HDL-cholesterol and activities of hepatic marker enzymes, such as aspartate aminotransferase (AST), alanine aminotransferase (ALT), alkaline phosphatase (ALP) and acid phosphatase (ACP) in normal and streptozotocin diabetic rats." |
Sequence & Structure:
MVLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGKKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPAMHASLDKFLASVSTVLTSKYR
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
